| Background |
4-1BB ligand (4-1BBL) is a type II transmembrane protein that is part of the tumor necrosis factor (TNF) ligand family. As an inducible co-stimulatory molecule, it presents on several antigen presenting cell (APC) types, including B cells, macrophages and DCs. The interactions between 4-1BB and 4-1BBL trigger pleiotropic effects on the immune response including antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells through NFκB, c-Jun, and p38 downstream signal pathways activation.Therefore, 4-1BB and 4-1BBL are recently used for the immunotherapy of cancer. |
| Synonyms |
4-1BB ligand, CD137L, TNLG5A, TNFSF9, Tumor necrosis factor ligand superfamily member 9 |
| Uniprot ID |
P41273 |
| Molecular Weight |
The protein has a calculated MW of 20.4 kDa.
The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>95% as determined by SDS-PAGE analysis. |
| Activity |
Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is 1-5 ng/mL. |
| Endotoxin Level |
<0.05 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4. |
| Application |
Cell Culture |
No references are available
