Recombinant TPO,Human,GMP
Catalog# Promotion Alternate Text Size Price Availability
CM124-100HPG 100 ug $1088.00
CM124-1000HPG 1 mg $4375.00
Inquire
Product Specifications
Background Thrombopoietin (TPO) is a glycoprotein that produced by the liver, kidney, marrow stroma and several other tissues. The TPO level in the blood is mostly negatively correlated with the abundance of platelets and bone marrow megakaryocytes, although multiple states of inflammation or infection, liver failure, and hematological disturbances are associated with unexpectedly high or low circulating levels of the hormone.
Synonyms thrombopoietin, Megakaryocyte colony-stimulating factor, c-MPL Ligand, MGDF, THPO
Uniprot ID P40225
Molecular Weight The protein has a calculated MW of 19.6 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >95% as determined by SDS-PAGE analysis.
Activity Measure by its ability to induce proliferation in MO7e cells. The ED₅₀ for this effect is <2 ng/mL.
Endotoxin Level <0.05 EU per 1 μg of the protein by the LAL method.
Protein Sequence SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL with polyhistidine tag at the N-terminus.
Protein Tag His Tag (N-term)
Form Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Application Cell Culture
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Scientific Data
SDS- PAGE analysis of GMP human TPO GMP Human TPO Protein, His Tag, E. coli induced MO7e cell proliferation.
Citations
No references are available
Related Products