Recombinant FGF-2 (aa 135-288.),Human,GMP
Catalog# Promotion Alternate Text Size Price Availability
CM091-100HPG 100 ug $1088.00
CM091-1000HPG 1 mg $4375.00
Inquire
Product Specifications
Background Basic fibroblast growth factor (FGF-2, bFGF, FGF-β), a 18 kDa pleiotropic cytokine, plays multiple roles in different cells and tissues. FGF-2 can stimulate smooth muscle cell growth, wound healing, and tissue repair. In addition, FGF-2 has been shown to regulate the generation of neurons and astrocytes from progenitor cells. FGF-2 are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. As a multifunctional cytokine, FGF-2 is first isolated from the pituitary. Later, it was identified from various cell types including cardiac myocytes, cardiac fibroblasts, endothelial cells, and smooth muscle cells.
Synonyms fibroblast growth factor basic, HBGF-2, Prostatropin, bFGF, FGF basic
Uniprot ID P09038
Molecular Weight The protein has a calculated MW of 18.1 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >98% as determined by SDS-PAGE analysis.
Activity Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant human FGF-2 is approximately >5 x 10⁵ IU/mg.
Endotoxin Level <0.05 EU per 1 μg of the protein by the LAL method.
Protein Sequence AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus.
Protein Tag His Tag (N-term)
Form Lyophilized from a 0.2 µm filtered solution of PBS containing 0.01% sarkosyl, pH 8
Application Cell Culture
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Scientific Data
SDS- PAGE analysis of GMP human FGF-2
Citations
No references are available
Related Products