Recombinant SCF,Human,GMP
Catalog# Promotion Alternate Text Size Price Availability
CM171-100HPG 100 ug $1438.00
CM171-1000HPG 1 mg $6500.00
Inquire
Product Specifications
Background Stem Cell Factor (SCF) is a 166-amino-acid protein with a monomeric molecular weight of approximately 18.5 kDa. SCF is the ligand for the tyrosine kinase receptor c-kit, which regulates other growth factors, such as granulocyte colony-stimulating factor (G-CSF), granulocyte macrophage-colony-stimulating factor (GM-CSF), and interleukin-3 to stimulate proliferation, and differentiation of hematopoietic stem cells. SCF can be produced by a variety of cells, including fibroblasts, smooth muscle, endothelial cells, mast cells and bone marrow macrophages endothelial cells.
Synonyms DCUA, DFNA69, FPH2, FPHH, KL-1, Kitl, MGF, SF, SHEP7, SLF, KIT ligand
Uniprot ID P21583
Molecular Weight The protein has a calculated MW of 19.4 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >98% as determined by SDS-PAGE analysis.
Activity Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <5 ng/mL. The specific activity of recombinant human SCF is > 5 x 10⁵ IU/mg.
Endotoxin Level <0.05 EU per 1 μg of the protein by the LAL method.
Protein Sequence MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA with polyhistidine tag at the C-terminus
Protein Tag His Tag (C-term)
Form Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Application Cell Culture
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Scientific Data
SDS- PAGE analysis of GMP human SCF
Citations
No references are available
Related Products