Recombinant Flt-3 Ligand,Human,GMP
Catalog# Promotion Alternate Text Size Price Availability
CM086-100HPG 100 ug $1438.00
CM086-1000HPG 1 mg $6500.00
Inquire
Product Specifications
Background Fms-related tyrosine kinase-3 ligand (Flt-3 Ligand) is a protein which is encoded by the FLT3LG gene in human. As an important regulator of hematopoiesis, Flt-3 ligand has a tyrosine-protein kinase activity that stimulate the proliferation of hematopoietic progenitor cells of both lymphoid and myeloid origin. Flt-3 ligand can synergistically increase the proliferation of immature progenitors with other cytokines such as GM-CSF, G-CSF, IL-3, EPO, IL-11, IL-12, IL-6 or TPO. Flt-3 ligand is expressed by a variety of hematopoietic progenitor cells including immature hematopoietic and marrow stromal cells.
Synonyms fms-related tyrosine kinase-3 ligand, FL, FLG3L, FLT3L
Uniprot ID P49771
Molecular Weight The protein has a calculated MW of 18.6 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >95% as determined by SDS-PAGE analysis.
Activity Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED₅₀ for this effect is <0.8 ng/mL. The specific activity of recombinant human Flt-3 Ligand is > 1.5 x 10⁶ IU/mg.
Endotoxin Level <0.05 EU per 1 μg of the protein by the LAL method.
Protein Sequence MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA with polyhistidine tag at the C-terminus.
Protein Tag His Tag (C-term)
Form Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Application Cell Culture
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Scientific Data
SDS- PAGE analysis of GMP human Flt-3 Ligand
Citations
No references are available
Related Products