| Background |
Stem Cell Factor (SCF) is a 166-amino-acid protein with a monomeric molecular weight of approximately 18.5 kDa. SCF is the ligand for the tyrosine kinase receptor c-kit, which regulates other growth factors, such as granulocyte colony-stimulating factor (G-CSF), granulocyte macrophage-colony-stimulating factor (GM-CSF), and interleukin-3 to stimulate proliferation, and differentiation of hematopoietic stem cells. SCF can be produced by a variety of cells, including fibroblasts, smooth muscle, endothelial cells, mast cells and bone marrow macrophages endothelial cells. |
| Synonyms |
DCUA, DFNA69, FPH2, FPHH, KL-1, Kitl, MGF, SF, SHEP7, SLF, KIT ligand |
| Uniprot ID |
P21583 |
| Molecular Weight |
The protein has a calculated MW of 19.4 kDa.
The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE analysis. |
| Activity |
Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <5 ng/mL. The specific activity of recombinant human SCF is > 5 x 10⁵ IU/mg. |
| Endotoxin Level |
<0.05 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA with polyhistidine tag at the C-terminus |
| Protein Tag |
His Tag (C-term) |
| Form |
Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4. |
| Application |
Cell Culture |
No references are available
