| Background |
Fms-related tyrosine kinase-3 ligand (Flt-3 Ligand) is a protein which is encoded by the FLT3LG gene in human. As an important regulator of hematopoiesis, Flt-3 ligand has a tyrosine-protein kinase activity that stimulate the proliferation of hematopoietic progenitor cells of both lymphoid and myeloid origin. Flt-3 ligand can synergistically increase the proliferation of immature progenitors with other cytokines such as GM-CSF, G-CSF, IL-3, EPO, IL-11, IL-12, IL-6 or TPO. Flt-3 ligand is expressed by a variety of hematopoietic progenitor cells including immature hematopoietic and marrow stromal cells. |
| Synonyms |
fms-related tyrosine kinase-3 ligand, FL, FLG3L, FLT3L |
| Uniprot ID |
P49771 |
| Molecular Weight |
The protein has a calculated MW of 18.6 kDa.
The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>95% as determined by SDS-PAGE analysis. |
| Activity |
Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED₅₀ for this effect is <0.8 ng/mL. The specific activity of recombinant human Flt-3 Ligand is > 1.5 x 10⁶ IU/mg. |
| Endotoxin Level |
<0.05 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0. |
| Application |
Cell Culture |
No references are available
