GMP级别细胞因子

Recombinant TPO，Human，GMP

Datasheet

Catalog#	Promotion	Size	Price	Availability
CM124-100HPG		100 ug	$1088.00
CM124-1000HPG		1 mg	$4375.00

Inquire

Product Specifications

Background	Thrombopoietin (TPO) is a glycoprotein that produced by the liver, kidney, marrow stroma and several other tissues. The TPO level in the blood is mostly negatively correlated with the abundance of platelets and bone marrow megakaryocytes, although multiple states of inflammation or infection, liver failure, and hematological disturbances are associated with unexpectedly high or low circulating levels of the hormone.
Synonyms	thrombopoietin, Megakaryocyte colony-stimulating factor, c-MPL Ligand, MGDF, THPO
Uniprot ID	P40225
Molecular Weight	The protein has a calculated MW of 19.6 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Expression System	Escherichia coli
Purity	>95% as determined by SDS-PAGE analysis.
Activity	Measure by its ability to induce proliferation in MO7e cells. The ED₅₀ for this effect is <2 ng/mL.
Endotoxin Level	<0.05 EU per 1 μg of the protein by the LAL method.
Protein Sequence	SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL with polyhistidine tag at the N-terminus.
Protein Tag	His Tag (N-term)
Form	Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Application	Cell Culture

Storage/Shipping

Stability & Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping	Blue Ice

Product Note

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Scientific Data


SDS- PAGE analysis of GMP human TPO	GMP Human TPO Protein, His Tag, E. coli induced MO7e cell proliferation.

Citations

No references are available