| Background |
The transforming growth factor beta (TGF beta) family of cytokines are ubiquitous, multifunctional, and essential to survival. They play the central roles in growth, development, inflammation, repair, and host immunity. The mammalian TGF beta isoforms (TGF beta 1, beta 2 and beta 3) are secreted as potential precursors and possess a variety of cell surface receptors and produces at least two mediate signal transductions. |
| Synonyms |
tumor necrosis factor alpha, TNFSF2, Cachectin, Differentiation-inducing factor (DIF), Necrosin, Cytotoxin, TNS_x005fF1A |
| Uniprot ID |
P01137 |
| Molecular Weight |
The protein has a calculated MW of 13.7 kDa.
The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE analysis. |
| Activity |
Measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells. The ED₅₀ for this effect is <0.1 ng/mL. The specific activity of recombinant human TGF beat 1 is approximately >5 x 10⁷ IU/mg.
Measure by its ability to induce proliferation in MCF-7 cells. The ED₅₀ for this effect is <3.2 ng/mL. |
| Endotoxin Level |
<0.05 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0. |
| Application |
Cell Culture |
No references are available
