Recombinant IFN gamma,Human,GMP
Catalog# Promotion Alternate Text Size Price Availability
CM081-100HPG 100 ug $375.00
CM081-1000HPG 1 mg $1750.00
Inquire
Product Specifications
Background The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.
Synonyms interferon gamma, Type II interferon, T-cell interferon, MAF
Uniprot ID P01579
Molecular Weight The protein has a calculated MW of 17.7 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >95% as determined by SDS-PAGE analysis.
Activity Measure by its ability to induce cytotoxicity in HT29 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant human IFN gamma is approximately >2 x 10⁶ IU/mg, which is calibrated against the human IFN Gamma WHO Reference Material (NIBSC code: 87/586).
Endotoxin Level <0.05 EU per 1 μg of the protein by the LAL method.
Protein Sequence MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ with polyhistidine tag at the C-terminus.
Protein Tag His Tag (C-term)
Form Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Application Cell Culture
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Scientific Data
SDS- PAGE analysis of GMP human IFN gamma GMP Human IFN Gamma Protein, His Tag, E. coli induces cytotoxicity in HT29 cells, with the ED₅₀ <1.0 ng/mL.
Citations
No references are available
Related Products