Recombinant IL-21,Human,GMP
Catalog# Promotion Alternate Text Size Price Availability
CM025-100HPG 100 ug $1163.00
CM025-1000HPG 1 mg $5250.00
Inquire
Product Specifications
Background Interleukin-21 (IL-21) belongs to the IL-15/IL-21 family, which exerts pleiotropic immune regulations. IL-21 produced primarily by natural killer T (NKT) cells, T follicular helper (TFH) cells and TH17 cells. As a pleiotropic cytokine, IL-21 has been shown to regulate both innate and humoral immunity. It has potent inhibitory activity towards the activation and maturation of granulocyte-macrophage colony-stimulating factor (GM-CSF)-induced dendritic cells (DCs). In B cells, IL-21 has a major role in the development of immunoglobulin responses. In T cells, it is required to facilitate the functional differentiation of several CD4+ T cell subsets. In addition, the ability of IL-21 to enhance the cytotoxic activity of both CD8+ T cells and NK cells makes it as a potential antitumor agent.
Synonyms interleukin 21, Za11, IL21
Uniprot ID Q9HBE4
Molecular Weight The protein has a calculated MW of 16.2 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >95% as determined by SDS-PAGE analysis.
Activity Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED₅₀ for this effect is <10 ng/mL.
Endotoxin Level <0.05 EU per 1 μg of the protein by the LAL method.
Protein Sequence MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS with polyhistidine tag at the C-terminus.
Protein Tag His Tag (C-term)
Form Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Application Cell Culture
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Scientific Data
SDS- PAGE analysis of GMP human IL-21 GMP Human IL-21 Protein, His Tag, E. coli enhances IFN gamma secretion in NK-92 cells, with the ED₅₀ <10 ng/mL
Citations
No references are available
Related Products