Background |
Interleukin-7 (IL-7) is a multipotent cytokine belonged to one of the members of IL-2 superfamily. IL-7 has diverse effects on the hematopoietic and immune regulations. IL-7 is a trophic factor that is necessary for both B cell and T cell proliferation and development. In addition, it presents potential antitumor effects in tumors such as glioma, melanoma, lymphoma, leukemia, prostate cancer, and glioblastoma. |
Synonyms |
interleukin 7, Lymphopoietin 1(LP-1), pre-B-cell factor, IL7 |
Uniprot ID |
P13232 |
Molecular Weight |
The protein has a calculated MW of 18.3 kDa.
The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis). |
Expression System |
Escherichia coli |
Purity |
>95% as determined by SDS-PAGE analysis. |
Activity |
Measured by its ability to induce PHA-activated human PBMCs proliferation. The ED₅₀ for this effect is <0.8 ng/mL. The specific activity of recombinant human IL-7 is > 1 x 10⁸ units/mg. |
Endotoxin Level |
<0.05 EU per 1 μg of the protein by the LAL method. |
Protein Sequence |
MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH with polyhistidine tag at the C-terminus. |
Protein Tag |
His Tag (C-term) |
Form |
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0. |
Application |
Cell Culture |