GMP级别细胞因子

Recombinant IL-7，Human，GMP

Datasheet

Catalog#	Promotion	Size	Price	Availability
CM009-100HPG		100 ug	$1438.00
CM009-1000HPG		1 mg	$6500.00

Inquire

Product Specifications

Background	Interleukin-7 (IL-7) is a multipotent cytokine belonged to one of the members of IL-2 superfamily. IL-7 has diverse effects on the hematopoietic and immune regulations. IL-7 is a trophic factor that is necessary for both B cell and T cell proliferation and development. In addition, it presents potential antitumor effects in tumors such as glioma, melanoma, lymphoma, leukemia, prostate cancer, and glioblastoma.
Synonyms	interleukin 7, Lymphopoietin 1(LP-1), pre-B-cell factor, IL7
Uniprot ID	P13232
Molecular Weight	The protein has a calculated MW of 18.3 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Expression System	Escherichia coli
Purity	>95% as determined by SDS-PAGE analysis.
Activity	Measured by its ability to induce PHA-activated human PBMCs proliferation. The ED₅₀ for this effect is <0.8 ng/mL. The specific activity of recombinant human IL-7 is > 1 x 10⁸ units/mg.
Endotoxin Level	<0.05 EU per 1 μg of the protein by the LAL method.
Protein Sequence	MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH with polyhistidine tag at the C-terminus.
Protein Tag	His Tag (C-term)
Form	Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Application	Cell Culture

Storage/Shipping

Stability & Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping	Blue Ice

Product Note

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Scientific Data


SDS- PAGE analysis of GMP human IL-7	GMP Human IL-7 Protein, His Tag, E. coli stimulates the proliferation of PHA-activated human peripheral blood lymphocytes (PBMC), with the ED₅₀ < 0.8 ng/mL.

Citations

No references are available