| Background |
Interleukin-6 (IL-6) is a pleiotropic, 22-28 kDa cytokine which plays fundamental role in the acute phase response, inflammation, bone metabolism, lymphocyte differentiation and cancer progression. Deregulation of IL-6 production was also found in several diseases, including rheumatoid arthritis, Alzheimer’s disease, autoimmune deficiency disease and different types of cancer. |
| Synonyms |
interleukin 6, IFN-β2, B-Cell Differentiation Factor (BCDF), BSF-2, HPGF, HSF, MGI-2, IL6 |
| Uniprot ID |
P05231 |
| Molecular Weight |
The protein has a calculated MW of 21.8 kDa.
The protein migrates as 22 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE analysis. |
| Activity |
Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant human IL-6 is approximately >5 x 10⁸ IU/mg.
Measure by its ability to induce proliferation in MCF-7 cells. The ED₅₀ for this effect is <4.4 ng/mL. |
| Endotoxin Level |
<0.05 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0. |
| Application |
Cell Culture |