Recombinant IL-6,Human,GMP
Catalog# Promotion Alternate Text Size Price Availability
CM008-100HPG 100 ug $963.00
CM008-1000HPG 1 mg $4375.00
Inquire
Product Specifications
Background Interleukin-6 (IL-6) is a pleiotropic, 22-28 kDa cytokine which plays fundamental role in the acute phase response, inflammation, bone metabolism, lymphocyte differentiation and cancer progression. Deregulation of IL-6 production was also found in several diseases, including rheumatoid arthritis, Alzheimer’s disease, autoimmune deficiency disease and different types of cancer.
Synonyms interleukin 6, IFN-β2, B-Cell Differentiation Factor (BCDF), BSF-2, HPGF, HSF, MGI-2, IL6
Uniprot ID P05231
Molecular Weight The protein has a calculated MW of 21.8 kDa. The protein migrates as 22 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >98% as determined by SDS-PAGE analysis.
Activity Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant human IL-6 is approximately >5 x 10⁸ IU/mg. Measure by its ability to induce proliferation in MCF-7 cells. The ED₅₀ for this effect is <4.4 ng/mL.
Endotoxin Level <0.05 EU per 1 μg of the protein by the LAL method.
Protein Sequence MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM with polyhistidine tag at the C-terminus.
Protein Tag His Tag (C-term)
Form Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Application Cell Culture
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Scientific Data
SDS- PAGE analysis of GMP human IL-6
Citations
No references are available
Related Products