| Background |
Interleukin-4 (IL-4) is a key cytokine produced by activated T cells, mast cells, basophils, neutrophils and eosinophils. IL-4 is critical for the development of Th2-mediated responses, which is related to allergy and asthma. It can also regulate B cell responses, including survival, cell proliferation and gene expression. IL-4 also plays fundamental role for B-cell stimulation, including induction of the IgE isotype switch. |
| Synonyms |
interleukin 4, BCGF, BCDF, B-cell Stimulating Factor (BSF-1), IL4 |
| Uniprot ID |
P05112 |
| Molecular Weight |
The protein has a calculated MW of 15.9 kDa.
The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE analysis. |
| Activity |
Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <0.2 ng/mL. The specific activity of recombinant human IL-4 is approximately >2.8 x 10⁷ IU/mg. |
| Endotoxin Level |
<0.05 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0. |
| Application |
Cell Culture |
No references are available
