Recombinant IL-3,Human,GMP
Catalog# Promotion Alternate Text Size Price Availability
CM005-100HPG 100 ug $1375.00
CM005-1000HPG 1 mg $6000.00
Inquire
Product Specifications
Background Interleukin-3 (IL-3) is a pleiotropic cytokine which can stimulates the survival, differentiation and proliferation of committed progenitor cells, including megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. IL-3 also enhances phagocytosis and antibody-mediated cellular cytotoxicity. IL-3 binds to IL-3R (IL-3 receptor), which is composed of a unique α subunit (IL-3Rα) and a common β-subunit (βc).
Synonyms interleukin 3, MCGF (Mast Cell Growth Factor), Multi-CSF, HCGF, P-cell stimulation factor, Interleukin-3b, IL3
Uniprot ID P08700
Molecular Weight The protein has a calculated MW of 16 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >98% as determined by SDS-PAGE analysis.
Activity Measure by its ability to induce TF-1 cells proliferation.The ED₅₀ for this effect is <0.15 ng/mL.The specific activity of recombinant human IL-3 is approximately >1.2 x 10⁶ IU/mg.
Endotoxin Level <0.05 EU per 1 μg of the protein by the LAL method.
Protein Sequence MAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF with polyhistidine tag at the C-terminus.
Protein Tag His Tag (C-term)
Form Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Application Cell Culture
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Scientific Data
SDS- PAGE analysis of GMP human IL-3
Citations
No references are available
Related Products