| Background |
Interleukin-3 (IL-3) is a pleiotropic cytokine which can stimulates the survival, differentiation and proliferation of committed progenitor cells, including megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. IL-3 also enhances phagocytosis and antibody-mediated cellular cytotoxicity. IL-3 binds to IL-3R (IL-3 receptor), which is composed of a unique α subunit (IL-3Rα) and a common β-subunit (βc). |
| Synonyms |
interleukin 3, MCGF (Mast Cell Growth Factor), Multi-CSF, HCGF, P-cell stimulation factor, Interleukin-3b, IL3 |
| Uniprot ID |
P08700 |
| Molecular Weight |
The protein has a calculated MW of 16 kDa.
The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE analysis. |
| Activity |
Measure by its ability to induce TF-1 cells proliferation.The ED₅₀ for this effect is <0.15 ng/mL.The specific activity of recombinant human IL-3 is approximately >1.2 x 10⁶ IU/mg. |
| Endotoxin Level |
<0.05 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0. |
| Application |
Cell Culture |
No references are available
