| Background |
Interleukin-1 beta (IL-1β) is a major cytokine expressed in macrophage, NK cells, monocytes, and neutrophils. It also plays fundamental role in inflammatory response, including monocyte activation, which is essential for the host defense and pathogen and pathogen resistance. Pro-IL-1β is cleaved by cytosolic caspase 1 to form mature IL-1β. |
| Synonyms |
interleukin 1 beta, Catabolin, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endoge_x005f_x005f_x005fnous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1, IL1B |
| Uniprot ID |
P01584 |
| Molecular Weight |
The protein has a calculated MW of 18.5 kDa.
The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE analysis. |
| Activity |
Measure by its ability to induce IL-8 secretion in HT29 cells. The ED₅₀ for this effect is <2.0 ng/mL. The specific activity of recombinant human IL-1 beta is approximately >3 x 10⁷ IU/mg, which is calibrated against the human IL-1 beta WHO International Standard (NIBSC code: 86/680). |
| Endotoxin Level |
<0.05 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0. |
| Application |
Cell Culture |