GMP级别细胞因子

Recombinant IL-1 beta，Human，GMP

Datasheet

Catalog#	Promotion	Size	Price	Availability
CM002-100HPG		100 ug	$1038.00
CM002-1000HPG		1 mg	$4688.00

Inquire

Product Specifications

Background	Interleukin-1 beta (IL-1β) is a major cytokine expressed in macrophage, NK cells, monocytes, and neutrophils. It also plays fundamental role in inflammatory response, including monocyte activation, which is essential for the host defense and pathogen and pathogen resistance. Pro-IL-1β is cleaved by cytosolic caspase 1 to form mature IL-1β.
Synonyms	interleukin 1 beta, Catabolin, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endoge_x005f_x005f_x005fnous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1, IL1B
Uniprot ID	P01584
Molecular Weight	The protein has a calculated MW of 18.5 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Expression System	Escherichia coli
Purity	>98% as determined by SDS-PAGE analysis.
Activity	Measure by its ability to induce IL-8 secretion in HT29 cells. The ED₅₀ for this effect is <2.0 ng/mL. The specific activity of recombinant human IL-1 beta is approximately >3 x 10⁷ IU/mg, which is calibrated against the human IL-1 beta WHO International Standard (NIBSC code: 86/680).
Endotoxin Level	<0.05 EU per 1 μg of the protein by the LAL method.
Protein Sequence	MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus.
Protein Tag	His Tag (C-term)
Form	Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Application	Cell Culture

Storage/Shipping

Stability & Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping	Blue Ice

Product Note

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Scientific Data


SDS- PAGE analysis of GMP human IL-1 beta	GMP Human IL-1 beta Protein, His Tag, E. coli induces IL-8 secretion in HT29 cells, with the ED₅₀ < 2.0 ng/mL.

Citations

No references are available