| Background |
Tumor necrosis factor alpha (TNF alpha) stimulates the acute phase of the immune response. In response to a pathogen, TNF alpha is one of the first to be released and can apply its effects in many organs. TNF alpha stimulates the release of corticotropic releasing hormone, suppresses appetite, and induces fever, in the hypothalamus. TNF increase vasodilation and loss of vascular permeability, it helps recruit lymphocyte, neutrophil, and monocyte to the inflammation site by regulating chemokine release. |
| Synonyms |
tumor necrosis factor alpha, TNFa, TNFSF2 |
| Uniprot ID |
P23563 |
| Molecular Weight |
The protein has a calculated MW of 18.1 kDa.
The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D.
The ED₅₀ for this effect is <15 pg/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
