| Background |
Interleukin-4 (IL-4) is a key cytokine produced by activated T cells, mast cells, basophils, neutrophils and eosinophils. IL-4 is critical for the development of Th2-mediated responses, which is related to allergy and asthma. It can also regulate B cell responses, including survival, cell proliferation and gene expression. IL-4 also plays fundamental role for B-cell stimulation, including induction of the IgE isotype switch. |
| Synonyms |
interleukin 4, IL4 |
| Uniprot ID |
Q04745 |
| Molecular Weight |
The protein has a calculated MW of 13.5 kDa.
The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce proliferation in TF-1 cells.
The ED₅₀ for this effect is <0.6 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
