| Background |
Interleukin 22 (IL-22) is an α-helical cytokine, predicts a molecular mass of 16.9 kDa. It is produced by T-helper (Th)-17 cells, γδ T cells, NKT cells and newly described innate lymphoid cells (ILCs). Effects involve stimulation of cell survival, proliferation and synthesis of antimicrobials including S110, Reg3β, Reg3γ and defensins. |
| Synonyms |
interleukin 22, IL-TIF, Cytokine ZCYTO18, If2b1, ILTIFa, IL22 |
| Uniprot ID |
Q9JJY9 |
| Molecular Weight |
The protein has a calculated MW of 17.58 kDa.
The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce IL-10 secretion in COLO205 cells.
The ED₅₀ for this effect is <0.3 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
