| Background |
Interleukin 16 (IL-16) predicts a molecular mass of 13.5 kDa, encoded by this gene is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication, and signaling process of this cytokine is mediated by CD4. |
| Synonyms |
interleukin 16, LCF (Lymphocyte Chemoattractant Factor), mKIAA4048, IL16 |
| Uniprot ID |
AAC04383.1 |
| Molecular Weight |
The protein has a calculated MW of 14.04 kDa.
The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>95% as determined by SDS-PAGE. |
| Activity |
Testing in process |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MHDLNSSTDSAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGDRTGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
