| Background |
The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases. |
| Synonyms |
interferon gamma, Type II interferon, T-cell interferon, MAF, Ifg, If2f, IFN-g |
| Uniprot ID |
P01580 |
| Molecular Weight |
The protein has a calculated MW of 16.5 kDa.
The protein migrates as 13-17 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to anti-viral assay in L-929 cells infected with encephalomyocarditis (EMC) virus.
The ED₅₀ for this effect is <0.5 ng/mL.
The specific activity of recombinant mouse IFN gamma is approximately >2x 10⁶ IU/mg. |
| Endotoxin Level |
<0.01 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
