| Background |
Granulocyte-macrophage colony-stimulating factor (GM-CSF) was first identified as a Growth Factors due to its ability to induce proliferation and differentiation of bone marrow progenitors into granulocytes and macrophages. GM-CSF is produced by multiple cell types including activated T cells, B cells, macrophages, endothelial cells and fibroblasts upon receiving immune stimuli. GM-CSF stimulates stem cells to produce granulocytes and monocytes functions as a cytokine. |
| Synonyms |
granulocyte-macrophage colony-stimulating factor, colony stimulating factor 2, CSF2, CSF, Csfg, Csfgm, GMCS, GMCSF, Gm-CS, Gm-CSf, MGI-I, MGI-IGM |
| Uniprot ID |
P01587 |
| Molecular Weight |
The protein has a calculated MW of 15.1 kDa.
The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce proliferation in FDC-P1 cells.
The ED₅₀ for this effect is <50 pg/mL.
The specific activity of recombinant mouse GM-CSF is approximately >2 x 10⁷ IU/mg. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK with polyhistidine tag at the N-terminus. |
| Protein Tag |
His Tag (N-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
