Recombinant GDNF,Mouse,Animal-Free
Catalog# Promotion Alternate Text Size Price Availability
CM083-5MP 5 ug $75.00
CM083-20MP 20 ug $188.00
CM083-100MP 100 ug $563.00
CM083-500MP 500 ug $1625.00
CM083-1000MP 1 mg $2500.00
Inquire
Product Specifications
Background Glial Cell Line-derived Neurotrophic Factor (GDNF) is the neurotrophic factor, belonging to the GDNF family of ligands (GFL) and identifying as a therapeutic candidate in Parkinson's disease. GDNF is a 23.7 kDa protein containing 211 residues that plays a critical role in promoting the survival and differentiation of midbrain dopamine neurons. Besides, GDNF is revealed to facilitate the development of peripheral tissues such as kidney, pancreas and lung. Additionally, as a member of GFL, GDNF also takes part in the progression of tumor.
Synonyms glial-derived neurotrophic factor, AI385739, ATF
Uniprot ID P48540
Molecular Weight The protein has a calculated MW of 15.91 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >98% as determined by SDS-PAGE.
Activity Testing in process
Endotoxin Level <0.1 EU per 1 μg of the protein by the LAL method.
Protein Sequence MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI with polyhistidine tag at the C-terminus.
Protein Tag His Tag (C-term)
Form The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Application Cell Culture
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Scientific Data
SDS- PAGE analysis of recombinant mouse GDNF
Citations
No references are available
Related Products