Recombinant CXCL7(48-109),Mouse,Animal-Free
Catalog# Promotion Alternate Text Size Price Availability
CM088-5MP 5 ug $75.00
CM088-20MP 20 ug $188.00
CM088-100MP 100 ug $563.00
CM088-500MP 500 ug $1625.00
CM088-1000MP 1 mg $2500.00
Inquire
Product Specifications
Background C-X-C motif chemokine 7 (CXCL7) also named Pro-Platelet basic protein (PPBP), which is a chemokine of the intercrine alpha family. CXCL7 is a 8.2 kDa protein containing 74 amino acid residues. CXCL7 is expressed by the platelets, which are activated. During vascular injury, CXCL7 controls the glucose metabolism, mitogenesis and neutrophil recruitment by the interaction with CXCR2.
Synonyms C-X-C motif chemokine 7, NAP-2, PPBP, CT, CTA, CTAP3, CTAPIII,LA-PF4, LDG, LDGF, MDGF, NAP-2-L1, Scyb, Scyb7, TGB, TGB1, THBGB1, b-TG1, beta-T, beta-TG
Uniprot ID NP_076274
Molecular Weight The protein has a calculated MW of 7.57 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >98% as determined by SDS-PAGE.
Activity Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <5 ng/mL.
Endotoxin Level <0.1 EU per 1 μg of the protein by the LAL method.
Protein Sequence IELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKI with polyhistidine tag at the N-terminus.
Protein Tag His Tag (N-term)
Form The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Application Cell Culture
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Scientific Data
SDS- PAGE analysis of recombinant mouse CXCL7 (48-109)
Citations
No references are available
Related Products