Recombinant CXCL3,Mouse,Animal-Free
Catalog# Promotion Alternate Text Size Price Availability
CM077-5MP 5 ug $75.00
CM077-20MP 20 ug $188.00
CM077-100MP 100 ug $563.00
CM077-500MP 500 ug $1625.00
CM077-1000MP 1 mg $2500.00
Inquire
Product Specifications
Background C-X-C motif chemokine 3 (CXCL3) also named Growth-regulated oncogene gamma (GROγ), which is a chemokine of the intercrine alpha family. CXCL3 is a 8 kDa protein containing 73 amino acid residues. During inflammation, CXCL3 is activated by the TNF and IL-1 which mediates the monocytes migration and adhesion by targeting the CXCR2. CXCL3 activates the JNK activity which induce the cell differentiation.
Synonyms C-X-C motif chemokine 3, Dci, Dcip1, Gm1960
Uniprot ID Q6W5C0
Molecular Weight The protein has a calculated MW of 8.72 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >98% as determined by SDS-PAGE.
Activity Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <80 ng/mL.
Endotoxin Level <0.1 EU per 1 μg of the protein by the LAL method.
Protein Sequence AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS with polyhistidine tag at the N-terminus.
Protein Tag His Tag (N-term)
Form The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Application Cell Culture
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Scientific Data
SDS- PAGE analysis of recombinant mouse CXCL3
Citations
No references are available
Related Products