| Background |
C-X-C motif chemokine 2 (CXCL2) also named Growth-regulated oncogene beta (GROβ), which is a chemokine of the intercrine alpha family. CXCL2 is a 8.1 kDa protein containing 73 amino acid residues. CXCL2 is often expressed in immune cells such as macrophages and monocytes. CXCL2 plays an important role with immune responses and cancer progression. CXCL2 activates the cell signal transduction with casepas1 that affects the cell proliferation, differentiation and migration. |
| Synonyms |
C-X-C motif chemokine 2, CINC, CINC-2a, GROb, Gr, Gro2, MIP, MIP-2, MIP-2a, Mgsa, Mgsa-b, Mi, Mip2, Scy, Scyb, Scyb2 |
| Uniprot ID |
P10889 |
| Molecular Weight |
The protein has a calculated MW of 8.66 kDa.
The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2.
The ED₅₀ for this effect is <0.5 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN with polyhistidine tag at the N-terminus. |
| Protein Tag |
His Tag (N-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
