| Background |
C-X-C motif chemokine 16 (CXCL16) is a chemokine of the intercrine alpha family which is a 9.8 kDa protein containing 88 amino acid residues. In mediate the innate immunity, CXCL16 is a chemotaxis for T cells and NKT cells, which expressed the CXC chemokine receptor (CXCR) 6. CXCL16 also can be enhanced the expression level by the TNFα, IL-1 and IFNγ. CXCL16 protects the host by against the gram positive and gram negitive bactreials.
|
| Synonyms |
C-X-C motif chemokine 16, SRPSOX |
| Uniprot ID |
Q8BSU2 |
| Molecular Weight |
The protein has a calculated MW of 10.74 kDa.
The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR6
The ED₅₀ for this effect is <3 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP with polyhistidine tag at the N-terminus. |
| Protein Tag |
His Tag (N-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
