Background |
CD27L is also named for CD70 which is one member of TNF family. CD27L is expressed on T and B lymphocytes and mature DCs. It binds the CD27, which is on the antigen-presenting cells. CD27L is a 19.2 kDa cytokine with 148 amino acid residues which is a transmembrane glycoprotein. CD27L plays an important role in the regulation of T cell proliferation which is also a good target of cancer immunotherapy. |
Synonyms |
CD27 ligand, soluble CD27 Ligand, sCD27 Ligand, TNFSF7, CD70, Tnfs, Tnlg8a |
Uniprot ID |
O55237 |
Molecular Weight |
The protein has a calculated MW of 17.25 kDa.
The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis). |
Expression System |
Escherichia coli |
Purity |
>98% as determined by SDS-PAGE. |
Activity |
Measure by its ability to induce proliferation in mouse T cells in the presence of the anti-CD3 antibody.
The ED₅₀ for this effect is <4.5 μg/mL. |
Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
Protein Sequence |
QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP with polyhistidine tag at the N-terminus. |
Protein Tag |
His Tag (N-term) |
Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
Application |
Cell Culture |