| Background |
C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1β (MIP-1β), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells, and epithelial cells. In addition, CCL4 participates in immune responses, including recruitment of immune cells like lymphocytes, monocytes, and leukocytes, response to IL-1 and IFNγ, and production of TNF when CCL4 binds to CCR5. |
| Synonyms |
C-C Motif Chemokine Ligand 4, MIP-1b: Macrophage Inflammatory Protein-1β, ACT-2 |
| Uniprot ID |
P14097 |
| Molecular Weight |
The protein has a calculated MW of 8.64 kDa.
The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to chemoattract human PBMCs using a concentration range of 20.0 - 200.0 ng/mL. Note: Results may vary from different PBMC donors. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN with polyhistidine tag at the N-terminus. |
| Protein Tag |
His Tag (N-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
