| Background |
Beta-Nerve Growth Factors (Beta-NGF) is a 27 kDa cytokine with 241 amino acid residues. Beta-NGF belongs to neurotrophin family, and acts as neurotrophic factors. It's composed of alpha, beta, gamma subnuits, and the beta subunit is related to its biological activity. Beta-NGF binds to p75 neurotrophin receptor and Trk receptor and their function is about cell death and survival, respectively. |
| Synonyms |
nerve growth factor-beta, β-Nerve Growth Factor, NGF-β |
| Uniprot ID |
P01139 |
| Molecular Weight |
The protein has a calculated MW of 14.41 kDa.
The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce TF-1 cells proliferation.
The ED₅₀ for this effect is <1ng/mL.
The specific activity of recombinant mouse beta-NGF is > 1 x 10⁶ IU/mg. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
