| Background |
Macrophage Colony Stimulating Factor (M-CSF) is a 18.54 kDa member of hematopoietic Growth Factors with 159 amino acid residues. M-CSF produced by osteoblasts and osteoblast precursors. M-CSF stimulates the growth and differentiation of the monocyte lineage, and promotes the survival, proliferation, and functions of mature monocytes/macrophages. |
| Synonyms |
macrophage colony stimulating factor, CSF-1, MGI-IM, CSF1 |
| Uniprot ID |
P09603 |
| Molecular Weight |
The protein has a calculated MW of 13.34 kDa.
The protein migrates as 13-26 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce proliferation in NFS-60 cells.
The ED₅₀ for this effect is <1 ng/mL.
The specific activity of recombinant human M-CSF is approximately >2.5x 10⁸ IU/mg. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
