| Background |
Interleukin 9 (IL-9) is a pleiotropic cytokine that had pleiotropic functions in the immune system, has a molecular mass of 14.5 kDa. The major source of IL-9 is T lymphocytes. It is secreted by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells. |
| Synonyms |
interleukin 9, p40 cytokine, T-cell growth factor p40, HP40, IL9 |
| Uniprot ID |
P15248 |
| Molecular Weight |
The protein has a calculated MW of 14.93 kDa.
The protein migrates as 13-17 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce proliferation in MO7e cells.
The ED₅₀ for this effect is <0.25 ng/mL.
The specific activity of recombinant human IL-9 is approximately >5 x10⁶ IU/ mg. |
| Endotoxin Level |
<0.01 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI with polyhistidine tag at the N-terminus. |
| Protein Tag |
His Tag (N-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
