Background |
Interleukin-4 (IL-4) is a key cytokine produced by activated T cells, mast cells, basophils, neutrophils and eosinophils. IL-4 is critical for the development of Th2-mediated responses, which is related to allergy and asthma. It can also regulate B cell responses, including survival, cell proliferation and gene expression. IL-4 also plays fundamental role for B-cell stimulation, including induction of the IgE isotype switch. |
Synonyms |
interleukin 4, BCGF, BCDF, B-cell Stimulating Factor (BSF-1), IL4 |
Uniprot ID |
P05112 |
Molecular Weight |
The protein has a calculated MW of 15.9 kDa.
The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis). |
Expression System |
Escherichia coli |
Purity |
>98% as determined by SDS-PAGE. |
Activity |
Measure by its ability to induce TF-1 cells proliferation.
The ED₅₀ for this effect is <0.2 ng/mL.
The specific activity of recombinant human IL-4 is approximately >2.8 x 10⁷ IU/mg. |
Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
Protein Sequence |
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS with polyhistidine tag at the C-terminus. |
Protein Tag |
His Tag (C-term) |
Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
Application |
Cell Culture |