| Background |
Interleukin-37 (IL-37) consists of 192 amino acids. IL-37 is a member of the interleukin-1 cytokine family. The primary function is binding to the interleukin-18 receptor (IL18R1 /IL-1Rrp) and then becoming a subunit to inhibit the activity of IL-18. This behavior often occurs between various immune responses. It also significantly affects the negative regulation of tumor necrosis factor production. |
| Synonyms |
interleukin 37, IL-1F7, IL-1ζ (zeta), IL-1H4, FIL1, FIL1Z, IL37 |
| Uniprot ID |
Q9NZH6 |
| Molecular Weight |
The protein has a calculated MW of 19.49 kDa.
The protein migrates as 22 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>95% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce IL-8 secretion in human PBMCs.
The ED₅₀ for this effect is <0.9 μg/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
