| Background |
Interleukin 20 (IL-20) predicts a molecular mass of 17.6 kDa. The IL-20 subfamily of cytokines is comprised of IL-19, IL-20, IL-22, IL-24, and IL-26. It regulates of differentiation of keratinocytes during inflammation, the expansion of multipotential hematopoietic progenitor cells. |
| Synonyms |
interleukin 20, Cytokine ZCYTO10, IL20 |
| Uniprot ID |
Q9NYY1 |
| Molecular Weight |
The protein has a calculated MW of 18.47 kDa.
The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to chemoattract BaF3 cells transfected with human IL-20R alpha and IL-20R beta.
The ED₅₀ for this effect is <0.2 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
