Background |
Interleukin 1 receptor antagonist (IL-1RA) is a 17.26 kDa member of IL-1 family with 153 amino acid residues. IL-1RA is expressed by peripheral blood cells, lungs, spleen, liver and is secreted from monocytes, macrophages, neutrophils, and other cells. Inhibits the activity of interleukin-1 by binding to receptor IL1R1. IL-1RA can modulate a variety of interleukin-1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. |
Synonyms |
interleukin 1 receptor antagonist, ICIL-1RA, IRAP, IL-1RN, IL1RA |
Uniprot ID |
P18510 |
Molecular Weight |
The protein has a calculated MW of 18.07 kDa.
The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis). |
Expression System |
Escherichia coli |
Purity |
>98% as determined by SDS-PAGE. |
Activity |
Measure by its ability to inhibit IL-1 alpha -dependent proliferation in D10.G4.1 cells.
The ED₅₀ for this effect is <50 ng/mL. |
Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
Protein Sequence |
MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE with polyhistidine tag at the C-terminus. |
Protein Tag |
His Tag (C-term) |
Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
Application |
Cell Culture |