| Background |
Interleukin 19 (IL-19) predicts a molecular mass of 35.8 kDa, is a type of anti-inflammatory cytokine. It promotes the Th2 T-cell response which supports an anti-inflammatory lymphocyte phenotype, dampens the Th1 T-cell response and IFNγ secretion, increases IL-10 expression in peripheral blood mononuclear cells, and inhibits the production of IgG from B cells. |
| Synonyms |
interleukin 19, Melanoma differentiation-associated protein-like protein, IL19 |
| Uniprot ID |
Q9UHD0 |
| Molecular Weight |
The protein has a calculated MW of 18.69 kDa.
The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta.
The ED₅₀ for this effect is <1.2 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA with polyhistidinetag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
