| Background |
Interleukin 17F (IL-17F) predicts a molecular mass of 30.1 kDa, is a cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. It is involved in the development of inflammation and host defense against infection by inducing the expression of genes that encode other proinflammatory cytokines, such as tumor necrosis factor, interleukin 1, interleukin 6 and some members of the colony-stimulating factor family. |
| Synonyms |
interleukin 17F, CANDF6, IL17, IL17F, ML-1, ML1 |
| Uniprot ID |
Q96PD4 |
| Molecular Weight |
The protein has a calculated MW of 15.84 kDa.
The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce IL-6 secretion in 3T3 cells.
The ED₅₀ for this effect is <20 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium acetate, pH 4.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
