| Background |
Insulin like Growth Factors 2 (IGF-II) is a 7.48 kDa member of the Insulin-like Growth Factors with 67 amino acid residues. IGF-II is mainly expressed from placenta, extravillous trophoblasts, leydig cells, syncytiotrophoblasts, cytotrophoblasts, peritubular cells. IGF-II regulating fetoplacental development and tissue differentiation. In adults, IGF-II signaling involves glucose metabolism in adipose tissue, skeletal muscle and liver. It also has important implications for metabolic disorders and cancer. |
| Synonyms |
insulin-like growth factor-II, Somatamedin A |
| Uniprot ID |
P01344 |
| Molecular Weight |
The protein has a calculated MW of 8.28 kDa.
The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce MCF-7 cells proliferation.
The ED₅₀ for this effect is <3 ng/mL.
The specific activity of recombinant human IGF-II is > 3x 10⁵ IU/mg. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus. |
| Protein Tag |
His Tag (N-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
