| Background |
Interferon-Beta 1a (IFN-beta 1a) is a leukocyte interferon, which is a variant of Interferon-beta. IFN-beta 1a is a 19 kDa protein containing 166 amino acid residues. It could bind the interferon receptors that activates the signal transduction of immune responses through the Jak/STAT pathway in leukocytes and lymphoblastoid cells. |
| Synonyms |
interferon beta 1a, IFNB1, Type I Interferon |
| Uniprot ID |
P01574 |
| Molecular Weight |
The protein has a calculated MW of 20.84 kDa.
The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce apoptosis in HeLa cells.
The ED₅₀ for this effect is <15 ng/mL.
Measure by its ability to induce cytotoxicity in TF-1 cells.
The ED₅₀ for this effect is <0.1 ng/mL.
The specific activity of recombinant human IFN beta 1a is approximately >1 x10⁷ IU/ mg. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
