| Background |
Human Gastric intrinsic factor (GIF) is an intrinsic factor of the eukaryotic cobalamin family. Gastric intrinsic factor is a 44 kDa protein containing 380 amino acid residues. It is secreted from the parietal cells in gastric mucosa. Gastric intrinsic factor plays a major role in absorption and transportation of cobalamin and Cbl. It could form the comprised with Vit.B12 that avoid the destroy of Vit.B12. |
| Synonyms |
gastric intrinsic factor, CBLIF, IF, IFMH, INF, TCN3 |
| Uniprot ID |
P27352 |
| Molecular Weight |
The protein has a calculated MW of 46.23 kDa.
The protein migrates as 45 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Testing in process |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
