| Background |
Glial cell line-derived neurotrophic factor (GDNF) is the neurotrophic factor, belonging to the GDNF family of ligands (GFL) and identifying as a therapeutic candidate in Parkinson's disease. GDNF is a 23.7 kDa protein containing 211 residues that plays a critical role in promoting the survival and differentiation of midbrain dopamine neurons. Besides, GDNF is revealed to facilitate the development of peripheral tissues such as kidney, pancreas and lung. Additionally, as a member of GFL, GDNF also takes part in the progression of tumor. |
| Synonyms |
glial-derived neurotrophic factor, ATF, ATF1, ATF2, HFB1-GDNF, HSCR3 |
| Uniprot ID |
P39905 |
| Molecular Weight |
The protein has a calculated MW of 16.01 kDa.
The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>95% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce proliferation in SH-SY5Y cells.
The ED₅₀ for this effect is <10 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
