| Background | Galectin-9 (Gal-9) is a lectin family member and is one of the tandem repeat-type galectins containing two carbohydrate recognition domains (CRD) connected by a linker region in a single peptide chain. The CRD is responsible for β-galactoside binding, and several binding partners for galectin-9 have been identified, including CD44, FGL, Gcgr, GLUT- 2, IgE, IgM, PDI, and Tim-3. Galectin-9 is constitutively presented in the small intestine, liver, uterine epithelial cells, skin epidermis, and esophageal epithelium. Galectin-9 contributing to cell growth, differentiation, adhesion, communication, and death. Accumulated evidence indicates that Gal-9 blockade promotes T cell immunity against tumors, suggesting that galectin-9 is a promising target for immunotherapy. |
| Synonyms | LGALS9, HUATA, LGALS9 |
| Uniprot ID | O00182 |
| Molecular Weight | The protein has a calculated MW of 36.7 kDa. The protein migrates as 37 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System | Escherichia coli |
| Purity | >98% as determined by SDS-PAGE. |
| Activity | Measured by its ability of the immobilized protein to support the adhesion of Jurkat cells. The ED₅₀ for this effect is <3 μg/mL. |
| Endotoxin Level | <0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence | AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT with polyhistidine tag at the N-terminus. |
| Protein Tag | His Tag (N-term) |
| Form | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application | Cell Culture |
| Stability & Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Shipping | Blue Ice |
 |
| SDS- PAGE analysis of recombinant human Galectin-9 |
No references are available
Follow Us
