| Background |
Fibroblast Growth Factors-9 (FGF-9) is a 23.4 kDa member of the fibroblast Growth Factors with 208 amino acid residues. FGF-9 is an important role embryonic development, cell proliferation, cell differentiation and cell migration in cell functions. It can regulate bone development, glial cell growth and differentiation during development, angiogenesis, differentiation and survival of neuronal cells. |
| Synonyms |
fibroblast growth factor 9, GAF (Glia-Activating Factor), HBGF-9, FGF9 |
| Uniprot ID |
P31371 |
| Molecular Weight |
The protein has a calculated MW of 22.14 kDa.
The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>95% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce 3T3 cells proliferation.
The ED₅₀ for this effect is <2 ng/mL. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
