| Background |
Fibroblast Growth Factors-18 (FGF-18) is a 24 kDa member of the fibroblast Growth Factors with 207 amino acid residues. FGF-18 is mainly expressed from glandular and luminal cells, cardiomyocytes, breast myoepithelial cells and endometrial ciliated cells. FGF-18 involved cell proliferation, cell differentiation and cell migration. FGF-18 is an important role in skeletal growth and development, stimulates hepatic and intestinal proliferation. |
| Synonyms |
fibroblast growth factor 18, FGFI, zFGF5, FGF18 |
| Uniprot ID |
O76093 |
| Molecular Weight |
The protein has a calculated MW of 21.11 kDa.
The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis). |
| Expression System |
Escherichia coli |
| Purity |
>98% as determined by SDS-PAGE. |
| Activity |
Measure by its ability to induce 3T3 cells proliferation.
The ED₅₀ for this effect is 1.3-2.0 ng/mL.
The specific activity of recombinant human FGF-18 is > 5 x 10⁵ IU/mg. |
| Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Protein Sequence |
MAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR with polyhistidine tag at the C-terminus. |
| Protein Tag |
His Tag (C-term) |
| Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us. |
| Application |
Cell Culture |
No references are available
