Recombinant FGF-16,Human,Animal-Free
Catalog# Promotion Alternate Text Size Price Availability
CM105-5HP 5 ug $75.00
CM105-20HP 20 ug $188.00
CM105-100HP 100 ug $563.00
CM105-500HP 500 ug $1625.00
CM105-1000HP 1 mg $2500.00
Inquire
Product Specifications
Background Fibroblast Growth Factors-16 (FGF-16) is a 23.8 kDa member of the fibroblast Growth Factors with 207 amino acid residues. FGF-16 is mainly expressed from melanocytes, fibroblasts. FGF-16 involved embryonic development, cell proliferation and cell differentiation, and is required for normal cardiomyocyte proliferation and heart development.
Synonyms fibroblast growth factor 16, FGFG, FGF16
Uniprot ID O43320
Molecular Weight The protein has a calculated MW of 24.57 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis).
Expression System Escherichia coli
Purity >95% as determined by SDS-PAGE.
Activity Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <31 ng/mL. The specific activity of recombinant human FGF-16 is > 3 x 10⁴ IU/mg.
Endotoxin Level <0.1 EU per 1 μg of the protein by the LAL method.
Protein Sequence MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPV DPSKLPSMSR DLFHYR with polyhistidine tag at the C-terminus.
Protein Tag His Tag (C-term)
Form The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Application Cell Culture
Storage/Shipping
Stability & Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Shipping Blue Ice
Product Note
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Scientific Data
SDS- PAGE analysis of recombinant human FGF-16
Citations
No references are available
Related Products