Background |
C-X-C motif chemokine 7 (CXCL7) also named Pro-Platelet basic protein (PPBP), which is a chemokine of the intercrine alpha family. CXCL7is a 7.7 kDa protein containing 70 amino acid residues. CXCL7 is expressed by the platelets, which are activated. During vascular injury, CXCL7 controls the glucose metabolism, mitogenesis and neutrophil recruitment by the interaction with CXCR2. |
Synonyms |
C-X-C motif chemokine 7, Neutrophil Activating Protein-2, NAP-2, PBP (parent molecule), CTAP-III (precursor) |
Uniprot ID |
P02775 |
Molecular Weight |
The protein has a calculated MW of 8.43 kDa.
The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis). |
Expression System |
Escherichia coli |
Purity |
>98% as determined by SDS-PAGE. |
Activity |
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2.
The ED₅₀ for this effect is <0.5 ng/mL. |
Endotoxin Level |
<0.1 EU per 1 μg of the protein by the LAL method. |
Protein Sequence |
AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD with polyhistidine tag at the N-terminus. |
Protein Tag |
His Tag (N-term) |
Form |
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us. |
Application |
Cell Culture |